The domain within your query sequence starts at position 167 and ends at position 520; the E-value for the Fanconi_A_N domain shown below is 3.7e-146.
LWKAQNSLLLEAMWRLHTHSVVSLQELLQSHPDSEAMAMWLFRNLRSLCEQIGASCPSPD TTEAMLSGLVQLLISRGFQGSSDPRRLVEPERLPQVATDVLQRMLAFSLDTLEADPQTTL DCQAVSGWIPIYSGHTCCGVVTENSLKSFFSHTLTQILTHKPVLKVSDAIQMQKEWSFAK THHLLTDLHCRVLATLGPEESVGRLQEVLEMQEVNWQHVLSCVSTLVVCFPEAQQLVKGW VASLMARAFESYHLDSMVTAFLIVRQATLEGPYVFPSYADWFKESFGSSHGYHSCSKKTL VFLFKFLSDLVPWEAPRYMQVHIFHPPLVPSKYHSLLTDYISLAKTRLADLKVS
Fanconi_A_N |
![]() |
---|
PFAM accession number: | PF15865 |
---|---|
Interpro abstract (IPR031729): | Fanconi anemia (FA) is a human disorder characterized by cancer susceptibility and cellular sensitivity to DNA crosslinks and other damages. The FA complex repairs the interstrand cross-linking (ICL) lesions and coordinates activities of the downstream DNA repair pathway including nucleotide excision repair, translesion synthesis, and homologous recombination. It is required for the monoubiquitylation of FANCD2 and FANCI heterodimer. The FA core complex consists of FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL, FANCM, FANCT (UBET2), FAAP100 and FAAP24 [ (PUBMED:29017571) (PUBMED:20347428) ]. This entry represents the N-terminal domain of FANCA. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fanconi_A_N