The domain within your query sequence starts at position 51 and ends at position 149; the E-value for the Fcf1 domain shown below is 2.5e-32.
RYLMGETQLCTTRCVLKELETLGKELYGAKLIAQKCQVRNCPHFKSPVSGSECLLSMVDE GNPHHYFVATQDQNLSVKVKRTPGIPLMFIIQNTIVLDK
Fcf1 |
---|
PFAM accession number: | PF04900 |
---|---|
Interpro abstract (IPR006984): | Utp23 share homology with PINc domain protein Fcf1. They are components of the small subunit processome (SSU) that are involved in rRNA-processing and ribosome biogenesis [ (PUBMED:16762320) (PUBMED:16769905) ]. Depletion of yeast Fcf1 and Fcf2 leads to a decrease in synthesis of the 18S rRNA and results in a deficit in 40S ribosomal subunits [ (PUBMED:16762320) ]. |
GO component: | small-subunit processome (GO:0032040) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fcf1