The domain within your query sequence starts at position 639 and ends at position 733; the E-value for the Fcf2 domain shown below is 3.4e-41.
RQKTAGNGWFGMKAPELTDELKNDLRALKMRAGMDPKRFYKKNDRDGFPKYFQVGTIVDN PADFYHSRIPKKQRKKTIVEELLADSEFRRFNRRK
Fcf2 |
 |
|---|
| PFAM accession number: | PF08698 |
|---|---|
| Interpro abstract (IPR014810): | This domain is found in eukaryotic nucleolar proteins that are involved in pre-rRNA processing [ (PUBMED:16762320) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fcf2