The domain within your query sequence starts at position 50 and ends at position 454; the E-value for the Fe-ADH domain shown below is 2.1e-105.

SNIRYGAGVTKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVR
VEPTDGSFMDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVNAPIGKG
KPVTVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHM
PCQVVANSGFDVLCHALESYTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALQIVA
KYLKRAVRNPDDLEARSKMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKEYNVD
HPLVPHGLSVVLTSPAVFTFTAQMFPERHLETAGILGANIRTARIQDAGLVLADALRKFL
FDLNVDDGLAALGYSKDDIPSLVKGTLPQERVTKLAPRAQSEEDL

Fe-ADH

Fe-ADH
PFAM accession number:PF00465
Interpro abstract (IPR001670):

Alcohol dehydrogenase ( EC 1.1.1.1 ) (ADH) catalyzes the reversible oxidation of ethanol to acetaldehyde with the concomitant reduction of NAD. Currently three, structurally and catalytically, different types of alcohol dehydrogenases are known:

  • Zinc-containing 'long-chain' alcohol dehydrogenases.
  • Insect-type, or 'short-chain' alcohol dehydrogenases.
  • Iron-containing alcohol dehydrogenases.

Iron-containing ADH's have been found in yeast (gene ADH4) [ (PUBMED:3584063) ], as well as in Zymomonas mobilis (gene adhB) [ (PUBMED:2823079) ]. These two iron-containing ADH's are closely related to the following enzymes:

  • Escherichia coli lactaldehyde reductase (also known as propanediol oxidoreductase) ( EC 1.1.1.77 ) (gene fucO) [ (PUBMED:2661535) ], an enzyme involved in the metabolism of fucose and which also seems to contain ferrous ion(s).
  • Clostridium acetobutylicum NADPH- and NADH-dependent butanol dehydrogenases ( EC 1.1.1 ) (genes adh1, bdhA and bdhB) [ (PUBMED:1385386) ], an enzyme which has activity using butanol and ethanol as substrates.
  • E. coli aldehyde-alcohol dehydrogenase (AdhE) [ (PUBMED:2015910) ], an iron-dependent enzyme which harbor three different activities: alcohol dehydrogenase, acetaldehyde dehydrogenase (acetylating) ( EC 1.2.1.10 ) and pyruvate-formate-lyase deactivase.
  • Bacterial glycerol dehydrogenase ( EC 1.1.1.6 ) (gene gldA or dhaD) [ (PUBMED:8132480) ].
  • Clostridium kluyveri NAD-dependent 4-hydroxybutyrate dehydrogenase (4hbd) ( EC 1.1.1.61 ).
  • Citrobacter freundii and Klebsiella pneumoniae 1,3-propanediol dehydrogenase ( EC 1.1.1.202 ) (gene dhaT).
  • Bacillus methanolicus NAD-dependent methanol dehydrogenase ( EC 1.1.1.244 ) [ (PUBMED:1644761) ].
  • E. coli and Salmonella typhimurium ethanolamine utilization protein eutG.
  • E. coli hypothetical protein yiaY.

GO process:oxidation-reduction process (GO:0055114)
GO function:metal ion binding (GO:0046872), oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fe-ADH