The domain within your query sequence starts at position 9 and ends at position 97; the E-value for the Filament_head domain shown below is 2.6e-18.
GNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSALAPRLAYSSAML SSAESSLDFSQSSSLLNGGSGGDYKLSRS
Filament_head |
 |
|---|
| PFAM accession number: | PF04732 |
|---|---|
| Interpro abstract (IPR006821): | This entry represents the N-terminal head domain of intermediate filaments. Intermediate filament heads bind DNA [ (PUBMED:11513613) ]. Vimentin heads are able to alter nuclear architecture and chromatin distribution, and the liberation of heads by HIV-1 protease liberates may play an important role in HIV-1 associated cytopathogenesis and carcinogenesis [ (PUBMED:11160829) ]. Phosphorylation of the head region can affect filament stability [ (PUBMED:12177195) ]. The head has been shown to interaction with the rod domain of the same protein [ (PUBMED:12064937) ]. |
| GO component: | intermediate filament (GO:0005882) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Filament_head