SMART: Pfam domain Fip1

The domain within your query sequence starts at position 153 and ends at position 195; the E-value for the Fip1 domain shown below is 6.6e-29.

EVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIR

Fip1

PFAM accession number:	PF05182
Interpro abstract (IPR007854):	This short motif is about 40 amino acids in length and is found in the Fip1 protein that is a component of a Saccharomyces cerevisiae pre-mRNA polyadenylation factor that directly interacts with poly(A) polymerase [ (PUBMED:7736590) ]. This region of Fip1 is needed for the interaction with the Yth1 subunit of the complex and for specific polyadenylation of the cleaved mRNA precursor [ (PUBMED:11238938) ].

PFAM accession number:

PF05182

Interpro abstract (IPR007854):

This short motif is about 40 amino acids in length and is found in the Fip1 protein that is a component of a Saccharomyces cerevisiae pre-mRNA polyadenylation factor that directly interacts with poly(A) polymerase [ (PUBMED:7736590) ]. This region of Fip1 is needed for the interaction with the Yth1 subunit of the complex and for specific polyadenylation of the cleaved mRNA precursor [ (PUBMED:11238938) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fip1