The domain within your query sequence starts at position 71 and ends at position 123; the E-value for the Fis1_TPR_C domain shown below is 2.1e-27.
RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGL
Fis1_TPR_C |
![]() |
---|
PFAM accession number: | PF14853 |
---|---|
Interpro abstract (IPR028061): | The mitochondrial fission protein Fis1 consists of two tetratricopeptide repeats. This entry represents the C-terminal tetratricopeptide repeat [ (PUBMED:14623186) (PUBMED:14705031) ]. Fis1 is an outer mitochondrial membrane protein that plays a role in mitochondrial membrane fission [ (PUBMED:11038183) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fis1_TPR_C