The domain within your query sequence starts at position 25 and ends at position 59; the E-value for the Fis1_TPR_N domain shown below is 3.1e-20.

KSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGS

Fis1_TPR_N

Fis1_TPR_N
PFAM accession number:PF14852
Interpro abstract (IPR028058):

The mitochondrial fission protein Fis1 consists of two tetratricopeptide repeats. This entry represents the N-terminal tetratricopeptide repeat [ (PUBMED:14623186) (PUBMED:14705031) ]. Fis1 is an outer mitochondrial membrane protein that plays a role in mitochondrial membrane fission [ (PUBMED:11038183) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fis1_TPR_N