The domain within your query sequence starts at position 33 and ends at position 65; the E-value for the Fis1_TPR_N domain shown below is 2.3e-18.
STQFEYAWCLVRSKYNEDIRRGIVLLEELLPKG
Fis1_TPR_N |
![]() |
---|
PFAM accession number: | PF14852 |
---|---|
Interpro abstract (IPR028058): | The mitochondrial fission protein Fis1 consists of two tetratricopeptide repeats. This entry represents the N-terminal tetratricopeptide repeat [ (PUBMED:14623186) (PUBMED:14705031) ]. Fis1 is an outer mitochondrial membrane protein that plays a role in mitochondrial membrane fission [ (PUBMED:11038183) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fis1_TPR_N