The domain within your query sequence starts at position 5 and ends at position 126; the E-value for the Flavodoxin_5 domain shown below is 2.7e-9.
LLLYATQRGQAKAIAEEISEQAVSHGFSADLHCISESEKYDLKTETGPLVMVVSTTGTGD PPDTARKFVKEIHNKTLPTDYFAHLQYGLLGLGDSEYTYFCNGGKVIDKRLQELGAQRFY DT
Flavodoxin_5 |
---|
PFAM accession number: | PF12724 |
---|---|
Interpro abstract (IPR026816): | This entry represents the flavodoxin domain. Proteins with this domain include protoporphyrinogen IX dehydrogenase (HemG). HemG catalyses the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX using menaquinone as electron acceptor [ (PUBMED:7788523) (PUBMED:7916647) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flavodoxin_5