SMART: Pfam domain Fmp27

The domain within your query sequence starts at position 446 and ends at position 674; the E-value for the Fmp27 domain shown below is 3.2e-24.

SISLDYQHLRPQSIHQRAVLTVDHLCWRVGSDSHIQRAPHPPNMHVWGEALVLDSFTLQG
SYNQPLGLSSTQSNTLFLDCTIRGLQVEISDICAQCLSRVLSLVIPQSERSAVSRKSSLG
ESVTLLWKVDLKVEDMNLFTLSALVGASELRLDTLTVLGSAETSTVGIQGLVLALVKSVT
EKMQPCCKAPDIPTPVLGLSMLSLTYHSSIRSLEVQCGAGLTLLWSPPD

Fmp27

PFAM accession number:	PF10344
Interpro abstract (IPR019439):	The function of the FMP27 protein is not known. FMP27 is the product of a nuclear encoded gene but it is detected in highly purified mitochondria in high-throughput studies [ (PUBMED:16823961) ]. This entry represents a conserved region in FMP27 that contains a characteristic FAQPTW sequence motif.

PFAM accession number:

PF10344

Interpro abstract (IPR019439):

The function of the FMP27 protein is not known. FMP27 is the product of a nuclear encoded gene but it is detected in highly purified mitochondria in high-throughput studies [ (PUBMED:16823961) ].

This entry represents a conserved region in FMP27 that contains a characteristic FAQPTW sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fmp27