The domain within your query sequence starts at position 263 and ends at position 522; the E-value for the Foie-gras_1 domain shown below is 3e-78.
NILEIKTMAGFINYKICRLCFQHNTPLDAIAQFRKHIDLCKKKIGSAELAFEHAAWMAKQ FQAFGDLFDEAIKLGLTAIQTQNPGFYYQQAAYYAQERKQHAKALCNHDAAVMYPNPDPL ETQSGVLDFYGQRPWRQGILSFDLSDPEKEKAGILAIQLKERSVVHSEIIIALLSNAVAQ FKKYKCPRMKSHLMVQMGEEYYYAKDYTKALKLLDYVMCDYRSEAWWTLLTSILTTALKC SYLMAQLKDYITYSLELLGR
Foie-gras_1 |
---|
PFAM accession number: | PF11817 |
---|---|
Interpro abstract (IPR021773): | This entry represents a domain found in trafficking protein particle complex subunit 11 (Trappc11), which is involved in endoplasmic reticulum to Golgi apparatus trafficking at a very early stage [ (PUBMED:21525244) ]. The C terminus of this region contains TPR repeats. In zebrafish, Trappc11 is also known as protein foie gras. It has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [ (PUBMED:16000385) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Foie-gras_1