The domain within your query sequence starts at position 344 and ends at position 566; the E-value for the Folliculin_C domain shown below is 8.4e-94.
TGFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVNLVHSAFEVLRTMLPVGCVRII PYSSQYEEAYRCNFLGLSPPVPIPAHVLASEFVVVVEVHTATRSNLHPAGCEDDQSLSKY EFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLICLKEEWMNKVKVLFKFTK VDSRPKEDTQKLLSVLGASEEDNVKLLKFWMTGLSKTYKSHLM
Folliculin_C |
![]() |
---|
PFAM accession number: | PF16692 |
---|---|
Interpro abstract (IPR032035): | This is the C-terminal domain of folliculin. This domain shares structural similarity with DENN domain of DENN1B (a Rab GEF), and has guanine nucleotide exchange factor (GEF) activity [ (PUBMED:22977732) ]. |
GO function: | guanyl-nucleotide exchange factor activity (GO:0005085) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Folliculin_C