The domain within your query sequence starts at position 319 and ends at position 374; the E-value for the Fox-1_C domain shown below is 2.9e-18.

IIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVDMQPTDMHS

Fox-1_C

 Fox-1_C
PFAM accession number:PF12414
Interpro abstract (IPR025670):

This domain is found in the C-terminal section of Fox-1 and its homologues, which regulate alternative splicing events by binding to 5'-UGCAUGU-3' elements [ (PUBMED:16537540) (PUBMED:15824060) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fox-1_C