The domain within your query sequence starts at position 35 and ends at position 77; the E-value for the FtsK_SpoIIIE domain shown below is 4.3e-8.

ENKLQKAVSVIEKVLRDIESAPLHIAVTGETGAGKSTFINTLR

FtsK_SpoIIIE

FtsK_SpoIIIE
PFAM accession number:PF01580
Interpro abstract (IPR002543):

The FtsK domain is a hydrophilic domain of about 200 residues, which is found in:

  • Bacterial cell division protein ftsK (known as sporulation protein SpoIIIE in Bacillus subtilis).
  • A set of conjugative plasmid- and conjugative transposon-encoded proteins, generally called Tra proteins. These proteins come from an extremly wide range of species, including Gram-positive and Gram-negative bacilli and cocci, Streptomyces species, Agrobacterium spp., and archaebacteria. In cases in which a function is known, the protein is required for intercellular DNA transfer.

The FtsK domain contains a highly conserved putative ATP-binding P-loop motif and is assumed to be cytoplasmic. It can be found in one to three copies and is thought to be involved in DNA translocation by coupling ATP hydrolysis to movement relative to the long axis of DNA [ (PUBMED:7592387) (PUBMED:11433368) (PUBMED:11973144) ].

GO function:DNA binding (GO:0003677), ATP binding (GO:0005524), nucleotide binding (GO:0000166)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FtsK_SpoIIIE