The domain within your query sequence starts at position 594 and ends at position 754; the E-value for the Fzo_mitofusin domain shown below is 1.6e-77.
LTQEELMVSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWT TKAKERAFKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQE IAAMNKKVEALDSLQSRAKLLRNKAGWLDSELNMFTHQYLQ
Fzo_mitofusin |
![]() |
---|
PFAM accession number: | PF04799 |
---|---|
Interpro abstract (IPR006884): | This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases. Fzo is a mediator of mitochondrial fusion during spermatogenesis [ (PUBMED:9230308) ]. This conserved region is also found in the human mitofusin protein [ (PUBMED:11181170) ]. This domain forms a dimeric antiparallel coiled coil structure, which has been proposed to act as a mitochodrial tether before vesicle fusion [ (PUBMED:15297672) ]. |
GO process: | mitochondrial fusion (GO:0008053) |
GO component: | integral component of membrane (GO:0016021), mitochondrial outer membrane (GO:0005741) |
GO function: | GTPase activity (GO:0003924) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fzo_mitofusin