The domain within your query sequence starts at position 35 and ends at position 210; the E-value for the G6PD_N domain shown below is 4.1e-60.

IIMGASGDLAKKKIYPTIWWLFRDGLLPKETFIVGYARSQLTVDDIQKQSEPFFKATPEE
RPKLEEFFTRNSYVVGQYDDPASYKHLNSYINALHQGMQANHLFYLALPPTVYEAVTKNI
QETCMSQTGFNRIIVEKPFGRDLQSSNQLSNHISSLFREDQIYRIDHYLDKEMVQN

G6PD_N

G6PD_N
PFAM accession number:PF00479
Interpro abstract (IPR022674):

Glucose-6-phosphate dehydrogenase ( EC 1.1.1.49 ) (G6PDH) is a ubiquitous protein, present in bacteria and all eukaryotic cell types [ (PUBMED:2838391) ]. The enzyme catalyses the the first step in the pentose pathway, i.e. the conversion of glucose-6-phosphate to gluconolactone 6-phosphate in the presence of NADP, producing NADPH. The ubiquitous expression of the enzyme gives it a major role in the production of NADPH for the many NADPH-mediated reductive processes in all cells [ (PUBMED:3393536) ]. Deficiency of G6PDH is a common genetic abnormality affecting millions of people worldwide. Many sequence variants, most caused by single point mutations, are known, exhibiting a wide variety of phenotypes [ (PUBMED:3393536) ].

This entry represents the NAD-binding domain of glucose-6-phosphate dehydrogenase.

GO process:glucose metabolic process (GO:0006006), oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on CH-OH group of donors (GO:0016614), NADP binding (GO:0050661)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry G6PD_N