The domain within your query sequence starts at position 36 and ends at position 119; the E-value for the GABP-alpha domain shown below is 4.9e-33.
ECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLS VQVISYQGMEPKLNILEIVKTAET
GABP-alpha |
![]() |
---|
PFAM accession number: | PF11620 |
---|---|
Interpro abstract (IPR024668): | GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats). This N-terminal domain found in the transcription factor GABP alpha consists of a five-stranded beta-sheet crossed by a distorted helix and has been termed OST domain. The surface of the GABP alpha OST domain contains two clusters of negatively-charged residues suggesting there are positively-charged partner proteins. The OST domain binds to the CH1 and CH3 domains of the co-activator histone acetyltransferase CBP/p300 [ (PUBMED:18295234) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GABP-alpha