The domain within your query sequence starts at position 355 and ends at position 451; the E-value for the GAD domain shown below is 2e-13.
LQDALAKPQGTVKAICVHDGAKYLRKEDIEFIRKFAVHHFSQEVLPIFLNAKKNWSSPFA KFIMEEERLELARSMEIQEEDIVLLTAGEHEKACSLL
GAD |
---|
PFAM accession number: | PF02938 |
---|---|
Interpro abstract (IPR029351): | This domain is found in the glutamyl-tRNA amidotransferase subunit E and some aspartyl tRNA ligases [ (PUBMED:16809540) (PUBMED:11566892) ]. The function of this domain is not yet known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GAD