The domain within your query sequence starts at position 2 and ends at position 201; the E-value for the GAIN domain shown below is 1.8e-51.
AEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARSLNKAMVETVNNLLQP QALNAWRDLTTSDQLRAATMLLDTVEESAFVLADNLLKTDIVRENTDNIQLEVARLSTEG NLEDLKFPENMGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEA MSTNHSVIVNSPVITAAINK
GAIN |
![]() |
---|
PFAM accession number: | PF16489 |
---|---|
Interpro abstract (IPR032471): | This entry represents the N-terminal region of the GAIN domain. The full GAIN domain, comprises this domain and the GPS motif ( IPR000203 ), can be found in cell-adhesion GPCRs, and is the functional unit for autoproteolysis. The GPS motif is an ancient domain that exists in primitive ancestor organisms, and the full GAIN domain is conserved in all cell-adhesion GPCRs and all PKD1-related proteins [ (PUBMED:22333914) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GAIN