The domain within your query sequence starts at position 1 and ends at position 181; the E-value for the GATA-N domain shown below is 4.4e-58.
MYQSLALAQSPGQGTYADSGAFLHSSGTGSPVFVAPTRMPSMLPYLPSCEPGSQAPALAA HSSWTQAVAADSSAFGSGSPHPPAAHPPGATTFPFAHSPPGSGSGGSAGVRDGGAFQGAL LAREQYPTPLGRPMGASYPTTYPAYMSSDVAPSWTSGAFDSSILHGLQARPGGLPGRRTS F
GATA-N |
---|
PFAM accession number: | PF05349 |
---|---|
Interpro abstract (IPR008013): | GATA transcription factors mediate cell differentiation in a diverse range of tissues. Mutations are often associated with certain congenital human disorders. The six classical vertebrate GATA proteins, GATA-1 to GATA-6, are highly homologous and have two tandem zinc fingers. The classical GATA transcription factors function as transcription activators. In lower metazoans GATA proteins carry a single canonical zinc finger. This entry represents the N-terminal domain of the family of GATA transcription activators. |
GO process: | positive regulation of transcription, DNA-templated (GO:0045893) |
GO component: | nucleus (GO:0005634) |
GO function: | zinc ion binding (GO:0008270), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GATA-N