The domain within your query sequence starts at position 64 and ends at position 287; the E-value for the GCD14 domain shown below is 3.2e-113.
GWVYVLHPTPELWTVNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIR SVAPTGHLHTVEFHQQRADKAREEFQEHRLSQWVTVHTQDVCCSGFGVVHVADAVFLDIP SPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAAHGFTELSTLEVLPQVYNVRTV SLPLPDLGANNLETNMGSDASPFRSGTPMKETVGHTGYLTFATK
GCD14 |
---|
PFAM accession number: | PF08704 |
---|---|
Interpro abstract (IPR014816): | Gcd14, also known as Trm61, is the catalytic subunit of tRNA (adenine-N(1)-)-methyltransferase [ (PUBMED:14739239) (PUBMED:10779558) ], which is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [ (PUBMED:9851972) ]. |
GO process: | tRNA methylation (GO:0030488) |
GO component: | tRNA (m1A) methyltransferase complex (GO:0031515) |
GO function: | tRNA (adenine-N1-)-methyltransferase activity (GO:0016429) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCD14