SMART: Pfam domain GCFC

The domain within your query sequence starts at position 597 and ends at position 812; the E-value for the GCFC domain shown below is 5.1e-39.

IDCIKAQFEAWRSKYYMSYKDAYIGLCLPKLFNPLIRLQLLTWTPLEAKCRDFETMLWFE
SLLFYGCEDREQEKDEADVALLPTIVEKVILPKLTVIAETMWDPFSTTQTSRMVGITMKL
INGYPSVVNADNKNTQVYLKALLLRMRRTLDDDVFMPLYPKNVLENKNSGPYLFFQRQFW
SSVKLLGNFLQWYGIFSNKTLQELSIDGLLNRYILM

GCFC

PFAM accession number:	PF07842
Interpro abstract (IPR022783):	This entry describes a domain found in a number of GC-rich sequence DNA-binding factor proteins and homologues [ (PUBMED:24304693) (PUBMED:22862948) ], as well as in a number of other proteins including Tuftelin-interacting protein 11 [ (PUBMED:19103666) ]. While the function of the domain is unknown, some of the proteins it is found in are reported to be involved in pre-mRNA splicing [ (PUBMED:19103666) (PUBMED:25568310) ]. This domain is also found in Sip1, a septin interacting protein [ (PUBMED:11884525) ].

PFAM accession number:

PF07842

Interpro abstract (IPR022783):

This entry describes a domain found in a number of GC-rich sequence DNA-binding factor proteins and homologues [ (PUBMED:24304693) (PUBMED:22862948) ], as well as in a number of other proteins including Tuftelin-interacting protein 11 [ (PUBMED:19103666) ]. While the function of the domain is unknown, some of the proteins it is found in are reported to be involved in pre-mRNA splicing [ (PUBMED:19103666) (PUBMED:25568310) ]. This domain is also found in Sip1, a septin interacting protein [ (PUBMED:11884525) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCFC