The domain within your query sequence starts at position 1 and ends at position 142; the E-value for the GCOM2 domain shown below is 1.6e-27.

MLDTSSLDPDCSSIDIKSSKSTSETQGPTHLTHRGNEETLEAGYTVNSSPAAHIRARAPS
SEVKEHLPQHSVSSQEEEISSSIDSLFITKLQKITIADQSEPSEENTSTENFPELQSETP
KKPHYMKVLEMRARNPVPPPHK

GCOM2

GCOM2
PFAM accession number:PF15328
Interpro abstract (IPR026213):

GRINL1 family consists of GRINL1A and GRINL1B. GRINL1 appears to be a stable component of the Pol II (G) complex form of RNA polymerase II (Pol II). Pol II synthesizes mRNA precursors and many functional non-coding RNAs and is the central component of the basal RNA polymerase II transcription machinery. GRINL1 may play a role in the Mediator complex-dependent regulation of transcription activation. It acts in vitro as a negative regulator of transcriptional activation; this repression is relieved by the Mediator complex, which restores Pol II(G) activator-dependent transcription to a level equivalent to that of Pol II [ (PUBMED:16769904) ].

GO component:RNA polymerase II, holoenzyme (GO:0016591)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCOM2