The domain within your query sequence starts at position 1 and ends at position 217; the E-value for the GDA1_CD39 domain shown below is 4.6e-72.
XSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQA LWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGD YEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQ EKMTEITKNFCSKSWEETQTQSKPALWIGEFSKVDKY
GDA1_CD39 |
![]() |
---|
PFAM accession number: | PF01150 |
---|---|
Interpro abstract (IPR000407): | A number of nucleoside diphosphate and triphosphate hydrolases as well as some yet uncharacterised proteins have been found to belong to the same family [ (PUBMED:8579614) (PUBMED:8703025) ]. The uncharacterised proteins all seem to be membrane-bound. |
GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GDA1_CD39