The domain within your query sequence starts at position 9 and ends at position 124; the E-value for the GFO_IDH_MocA domain shown below is 2.1e-22.

FGVVVVGVGRAGSVRIRDLKDPHSSAFLNLIGYVSRRELGSLDNVRQISLEDALRSQEVD
VAYICTESSSHEDYIRQFLQAGKHVLVEYPMALSFAAAQELWELAAQKGRVLHEEH

GFO_IDH_MocA

• PFAM accession number: PF01408
• Interpro abstract (IPR000683):

  This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot. GFO is a glucose--fructose oxidoreductase, which converts D-glucose and D-fructose into D-gluconolactone and D-glucitol in the sorbitol-gluconate pathway. MOCA is a rhizopine catabolism protein which may catalyse the NADH-dependent dehydrogenase reaction involved in rhizopine catabolism. Other proteins belonging to this family include Gal80, a negative regulator for the expression of lactose and galactose metabolic genes; and several hypothetical proteins from yeast, Escherichia coli and Bacillus subtilis.

  The oxidoreductase, N-terminal domain is almost always associated with the oxidoreductase, C-terminal domain (see IPR004104 ).

• GO function: oxidoreductase activity (GO:0016491)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GFO_IDH_MocA