The domain within your query sequence starts at position 177 and ends at position 519; the E-value for the GH3 domain shown below is 1e-62.
PDGAKDPRTLLLEALISPGLRVLEARTAVELLDVFVGLEADGEELAEAIAAGILGTLLPK RAAELKEALEQGPRGLARRLWPKLQVVVTLDSGGQAEAVAALRVLWCQGLAFFSPAYAAS GGVVALNLWPERPQGSYLLPPGVPFIELLPIKEGTQEEAASTLLLTDAQREKEYELVLTN HTSLTRCRLGDVVQVVGTYNQCPVVRFTCRLGQTLNVRGEVTDETVFSVALAQAVGQWPG AKLLDHVCVESRVLDSCEGSAPHYEVFVELRGLRNLSEENRDKLDNCLQEASAQYKSLRF RGSVGPAKVHLVRPGSFRVLREALAAFSSSSCRPPEMPRVIRL
GH3 |
---|
PFAM accession number: | PF03321 |
---|---|
Interpro abstract (IPR004993): | GH3 protein was first isolated from Glycine max (soybean) as an early auxin-responsive gene [ (PUBMED:4041007) ]. Later, several plant GH3 family proteins have been identified and classified into three groups: group I proteins synthesise JA-amino acid conjugates [ (PUBMED:21619871) ], group II proteins produce indole-3-acetic acid (IAA) conjugates [ (PUBMED:15659623) ], group III protein are involved in the conjugation of amino acids to 4-substituted benzoate [ (PUBMED:19189963) ]. This entry also includes proteins from bacteria, fungi and animals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GH3