SMART: Pfam domain GHBP

The domain within your query sequence starts at position 325 and ends at position 628; the E-value for the GHBP domain shown below is 1.8e-132.

EGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKS
AGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTLKFAQSQKLNMEADLLCLDQKNLKN
LPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDI
TPAGGVVLSPGQKIKAGIAQGNTQREVATPCQENYSMNSAYFCESDAKKCIAVAPRMEAT
SCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATA
LPLP

GHBP

PFAM accession number:	PF12772
Interpro abstract (IPR025871):	Growth hormone receptor binding protein is produced either by proteolysis of the growth hormone receptor (GHR) at the cell surface thereby releasing its extracellular domain, the GHBP (growth hormone-binding protein), or, in rodents, by alternative processing of the GHR transcript. The sheddase proteolytic enzyme responsible for the cleavage is TACE (tumour necrosis factor-alpha-converting enzyme) [ (PUBMED:2825030) (PUBMED:14519102) ]. Growth hormone (GH) binding to GH receptor is the initial step that leads to the physiological functions of the hormone [ (PUBMED:17321774) ]. The biological effects of GHBP are determined by the serum levels of GH, which can vary. Low levels of GH can result in a dwarf phenotype and have been positively correlated with an increased life expectancy. High levels of GH can lead to gigantism or a clinical syndrome termed acromegaly and have been implicated in diabetic eye and kidney damage [ (PUBMED:11286784) ].

PFAM accession number:

PF12772

Interpro abstract (IPR025871):

Growth hormone receptor binding protein is produced either by proteolysis of the growth hormone receptor (GHR) at the cell surface thereby releasing its extracellular domain, the GHBP (growth hormone-binding protein), or, in rodents, by alternative processing of the GHR transcript. The sheddase proteolytic enzyme responsible for the cleavage is TACE (tumour necrosis factor-alpha-converting enzyme) [ (PUBMED:2825030) (PUBMED:14519102) ].

Growth hormone (GH) binding to GH receptor is the initial step that leads to the physiological functions of the hormone [ (PUBMED:17321774) ]. The biological effects of GHBP are determined by the serum levels of GH, which can vary. Low levels of GH can result in a dwarf phenotype and have been positively correlated with an increased life expectancy. High levels of GH can lead to gigantism or a clinical syndrome termed acromegaly and have been implicated in diabetic eye and kidney damage [ (PUBMED:11286784) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GHBP