SMART: Pfam domain GIT1

The domain within your query sequence starts at position 182 and ends at position 306; the E-value for the GIT1_C domain shown below is 2.4e-65.

HSVPSPTLPSTEDVIRKTEQITKNIQELLRAAQENKHDSYIPCSERIHVAVTEMAALFPK
KPKSDTVRTSLRLLTSSAYRLQSECRKALPGDSSLPTDVQLVTQQVIQCAYDIAKAAKQL
VTITT

GIT1_C

PFAM accession number:	PF12205
Interpro abstract (IPR022018):	This entry represents the C-terminal domain of the ARF GTPase-activating protein GIT1. GIT1 is an ArfGAP and scaffolding protein regulating cell adhesion and migration [ (PUBMED:24699139) ]. To perform this function, it localises p21-activated kinase (PAK) and PAK-interactive exchange factor to focal adhesions. Its activation is regulated by interaction between its paxillin-binding C-terminal and the LD motifs of paxillin. The C-terminal folds into a four helix bundle.

PFAM accession number:

PF12205

Interpro abstract (IPR022018):

This entry represents the C-terminal domain of the ARF GTPase-activating protein GIT1. GIT1 is an ArfGAP and scaffolding protein regulating cell adhesion and migration [ (PUBMED:24699139) ]. To perform this function, it localises p21-activated kinase (PAK) and PAK-interactive exchange factor to focal adhesions. Its activation is regulated by interaction between its paxillin-binding C-terminal and the LD motifs of paxillin. The C-terminal folds into a four helix bundle.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GIT1_C