The domain within your query sequence starts at position 27 and ends at position 179; the E-value for the GLTP domain shown below is 1.4e-46.
VLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSSPQSEHYASLQSMVAYE VSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLCSEAYNA TLANYHSWIVRQAVTVAFCALPSRKVFLEAMNM
GLTP |
![]() |
---|
PFAM accession number: | PF08718 |
---|---|
Interpro abstract (IPR014830): | Glycolipid transfer protein (GLTP) is a cytosolic protein that catalyses the intermembrane transfer of glycolipids such as glycosphingolipids, glyceroglycolipids, and possibly glucosylceramides, but not of phospholipids. The GLTP protein consists of a single domain with a multi-helical structure consisting of two layers of orthogonally packed helices [ (PUBMED:15504043) (PUBMED:16309699) ]. The GLTP domain is also found in trans-Golgi network proteins involved in Golgi-to-cell-surface membrane traffic [ (PUBMED:15107860) ]. |
GO process: | intermembrane lipid transfer (GO:0120009) |
GO component: | cytoplasm (GO:0005737) |
GO function: | lipid transfer activity (GO:0120013) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GLTP