SMART: Pfam domain GMP_PDE

The domain within your query sequence starts at position 13 and ends at position 172; the E-value for the GMP_PDE_delta domain shown below is 1.6e-82.

SPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAF
LRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFP
PLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYS

GMP_PDE_delta

PFAM accession number:	PF05351
Interpro abstract (IPR008015):	This entry represents a domain found in GMP-PDE delta subunit and related proteins. GMP-PDE delta subunit was originally identified as a fourth subunit of rod-specific cGMP phosphodiesterase (PDE) ( EC 3.1.4.35 ). The precise function of PDE delta subunit in the rod specific GMP-PDE complex is unclear. In addition, PDE delta subunit is not confined to photoreceptor cells but is widely distributed in different tissues. PDE delta subunit is thought to be a specific soluble transport factor for certain prenylated proteins and Arl2-GTP a regulator of PDE-mediated transport [ (PUBMED:11980706) ].

PFAM accession number:

PF05351

Interpro abstract (IPR008015):

This entry represents a domain found in GMP-PDE delta subunit and related proteins.

GMP-PDE delta subunit was originally identified as a fourth subunit of rod-specific cGMP phosphodiesterase (PDE) ( EC 3.1.4.35 ). The precise function of PDE delta subunit in the rod specific GMP-PDE complex is unclear. In addition, PDE delta subunit is not confined to photoreceptor cells but is widely distributed in different tissues. PDE delta subunit is thought to be a specific soluble transport factor for certain prenylated proteins and Arl2-GTP a regulator of PDE-mediated transport [ (PUBMED:11980706) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMP_PDE_delta