The domain within your query sequence starts at position 80 and ends at position 212; the E-value for the GMP_PDE_delta domain shown below is 1.3e-60.
EENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLR LRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPL SEELILKSLQGLA
GMP_PDE_delta |
![]() |
---|
PFAM accession number: | PF05351 |
---|---|
Interpro abstract (IPR008015): | This entry represents a domain found in GMP-PDE delta subunit and related proteins. GMP-PDE delta subunit was originally identified as a fourth subunit of rod-specific cGMP phosphodiesterase (PDE) ( EC 3.1.4.35 ). The precise function of PDE delta subunit in the rod specific GMP-PDE complex is unclear. In addition, PDE delta subunit is not confined to photoreceptor cells but is widely distributed in different tissues. PDE delta subunit is thought to be a specific soluble transport factor for certain prenylated proteins and Arl2-GTP a regulator of PDE-mediated transport [ (PUBMED:11980706) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMP_PDE_delta