The domain within your query sequence starts at position 492 and ends at position 692; the E-value for the GMP_synt_C domain shown below is 1.4e-32.

EEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIP
RMCHNINRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGFAGKISQM
PVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGVPATPGNEIPVEVVLKMVTEIKK
IPGISRIMYDLTSKPPGTTEW

GMP_synt_C

• PFAM accession number: PF00958
• Interpro abstract (IPR001674):

  The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme. The ammonia intermediate does not dissociate into solution during the chemical transformations [ (PUBMED:10387030) ]. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. The C-terminal domain is specific to the GMP synthases EC 6.3.5.2 . In prokaryotes this domain mediates dimerisation. Eukaryotic GMP synthases are monomers. This domain in eukaryotes includes several large insertions that may form globular domains [ (PUBMED:8548458) ].

• GO process: purine nucleotide biosynthetic process (GO:0006164), GMP biosynthetic process (GO:0006177)
• GO function: ATP binding (GO:0005524), GMP synthase (glutamine-hydrolyzing) activity (GO:0003922)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMP_synt_C