The domain within your query sequence starts at position 16 and ends at position 90; the E-value for the GN3L_Grn1 domain shown below is 4.3e-25.

HKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLREAELRKQQLEELK
QQQKLDRQKEQERKR

GN3L_Grn1

GN3L_Grn1
PFAM accession number:PF08701
Interpro abstract (IPR014813):

This entry represents an N-terminal domain found in Guanine nucleotide-binding protein-like 3 [ (PUBMED:16012751) (PUBMED:12464630) ], Nuclear GTP-binding protein NUG1 [ (PUBMED:11583615) ], GTPase Grn1 [ (PUBMED:16251348) ] and other related proteins. The function of this domain is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GN3L_Grn1