SMART: Pfam domain GOLGA2L5

The domain within your query sequence starts at position 408 and ends at position 1026; the E-value for the GOLGA2L5 domain shown below is 2.1e-299.

QLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHTLKEEKEHRERQVQELETSLA
ALRSQMEEPPPPEPPAGPSEAEEQLQGEVEQLHKELERLTGQLRAQVQDNESLSHLNREQ
EGRLLELEREAQRWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLT
NENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQ
QYAAAYQQHLAAYEQLTSEKEAIHKQLLLQTQLMDQLQHEEVQGKMAAELARQELQEAQE
RLKATSQENQQLQAQLSLLVLPGEGDVDQEEEDEEVPQSSLAIPEDLDSREAMVAFFNAA
IARAEEEQARLRVQLKEQKARCRSLSHLAAPVQSKLEKEAVVPRNVDDSASEESNQALHV
AMEKLQSRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLE
KEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPGDVLTPVPTGSQE
FGAADQQDDLREVSLADDIEPAQGEAGVPAPHENPTAQQIMQLLREIQNPRERPGLGSNP
CIPFFYRADENDEVKIMVV

GOLGA2L5

PFAM accession number:	PF15070
Interpro abstract (IPR043976):	Members of the golgin subfamily A were identified as Golgi auto-antigens [ (PUBMED:8315394) ]. They might be involved in maintaining cis-Golgi structure [ (PUBMED:10677249) ]. One of the members of this family, member 2 or GM130, is a specific interacting partner of the small GTPase Rab1b [ (PUBMED:11306556) ] and plays a key role in the disassembly and reassembly of the Golgi apparatus during mitosis. GM130 is also involved in vesicle tethering and fusion at the cis-cisternae to facilitate transit between transport vesicles and the stacked cisternae. It interacts with GRASPs proteins, which mediate the stacking of Golgi cisternae [ (PUBMED:26363069) ]. Additionally, GM130 was localised to the spindle poles and regulates microtubule organization [ (PUBMED:21552007) ]. Structurally, GM130 is comprised of six coiled-coil regions in the middle, a Golgi-targeting domain at the C terminus, and a p115-interacting motif at the N terminus [ (PUBMED:26165940) ]. This entry represents the conserved domain found in the Golgin subfamily A members. This domain is comprised of coiled-coil in GM130 (GOLGA2) and related proteins [ (PUBMED:26165940) ].

PFAM accession number:

PF15070

Interpro abstract (IPR043976):

Members of the golgin subfamily A were identified as Golgi auto-antigens [ (PUBMED:8315394) ]. They might be involved in maintaining cis-Golgi structure [ (PUBMED:10677249) ]. One of the members of this family, member 2 or GM130, is a specific interacting partner of the small GTPase Rab1b [ (PUBMED:11306556) ] and plays a key role in the disassembly and reassembly of the Golgi apparatus during mitosis. GM130 is also involved in vesicle tethering and fusion at the cis-cisternae to facilitate transit between transport vesicles and the stacked cisternae. It interacts with GRASPs proteins, which mediate the stacking of Golgi cisternae [ (PUBMED:26363069) ]. Additionally, GM130 was localised to the spindle poles and regulates microtubule organization [ (PUBMED:21552007) ].

Structurally, GM130 is comprised of six coiled-coil regions in the middle, a Golgi-targeting domain at the C terminus, and a p115-interacting motif at the N terminus [ (PUBMED:26165940) ].

This entry represents the conserved domain found in the Golgin subfamily A members. This domain is comprised of coiled-coil in GM130 (GOLGA2) and related proteins [ (PUBMED:26165940) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GOLGA2L5