The domain within your query sequence starts at position 1 and ends at position 120; the E-value for the GPCR_chapero_1 domain shown below is 9.7e-31.
XKTGILGWRSEKTEMVNGYEAKVYGASNVELITRTRTEHLSEQHKGKVKGCKTPLQSFLG IAEQHGGPQNGTLITQTLSQANPPAITAEEYFNPNFELGNRAMGRPMELTTKTQNFPYPL
GPCR_chapero_1 |
 |
|---|
| PFAM accession number: | PF11904 |
|---|---|
| Interpro abstract (IPR021832): | This entry represents ankyrin repeat domain-containing protein 13 (ANKRD13). At least 4 subtypes are known to exist, termed A-D. ANKRD13C has been experimentally characterised and acts as a chaperone for biogenesis and folding of the DP receptor for prostaglandin D2 [ (PUBMED:20959461) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPCR_chapero_1