The domain within your query sequence starts at position 1128 and ends at position 1197; the E-value for the GPHH domain shown below is 1.8e-38.
LGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNM PLNSDGTVTF
GPHH |
 |
|---|
| PFAM accession number: | PF16905 |
|---|---|
| Interpro abstract (IPR031649): | This entry represents a domain found in voltage-dependent L-type calcium channel proteins from eukaryotes. The domain is closely associated with the IQ-domain ( IPR014873 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPHH