SMART: Pfam domain GSG-1

The domain within your query sequence starts at position 11 and ends at position 125; the E-value for the GSG-1 domain shown below is 2e-44.

SDQRTFISAILNMLSLGLSTASLLSSEWFVGTQKVPKPLCGQSLAAKCFDMPMSLDGGIA
NTSAQEVVQYTWETGDDRFSFLAFRSGMWLSCEETMEEPGEKCRRFIELTPPAQR

GSG-1

PFAM accession number:	PF07803
Interpro abstract (IPR012478):	This entry represents GSG1 (germ cell-specific gene 1 protein), a protein specifically expressed in testicular germ cells [ (PUBMED:9337410) ]. It has been shown to target testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions [ (PUBMED:18325338) ]. Overexpression of the human homologue may be involved in tumourigenesis of human testicular germ cell tumours [ (PUBMED:9337410) ].

PFAM accession number:

PF07803

Interpro abstract (IPR012478):

This entry represents GSG1 (germ cell-specific gene 1 protein), a protein specifically expressed in testicular germ cells [ (PUBMED:9337410) ]. It has been shown to target testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions [ (PUBMED:18325338) ]. Overexpression of the human homologue may be involved in tumourigenesis of human testicular germ cell tumours [ (PUBMED:9337410) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GSG-1