The domain within your query sequence starts at position 5 and ends at position 179; the E-value for the GSH_synth_ATP domain shown below is 1.8e-64.

WGSILQDEKQLEELAKQAIDRALAEGVLLRSAQHPSSSDVVTYAPFTLFPSPVPSALLEQ
AYAVQMDFNILVDAVSQNPAFLEQTLSSTIKKDDYTARLFDIYKQVLKEGIAQTVFLGLN
RSDYMFQCGADGSKALKQIEINTISASFGGLASRTPAVHRHVLNVLNKTKEASKI

GSH_synth_ATP

GSH_synth_ATP
PFAM accession number:PF03917
Interpro abstract (IPR005615):

This entry represents glutathione synthetase ( EC 6.3.2.3 ) (GSS), a homodimeric enzyme that catalyses the conversion of gamma-L-glutamyl-L-cysteine and glycine to phosphate and glutathione in the presence of ATP. This is the second step in glutathione biosynthesis, the first step being catalysed by gamma-glutamylcysteine synthetase [ (PUBMED:15981742) ]. In humans, defects in GSS are inherited in an autosomal recessive way and are the cause of severe metabolic acidosis, 5-oxoprolinuria, and increased rate of haemolysis and defective function of the central nervous system.

GO process:glutathione biosynthetic process (GO:0006750)
GO function:ATP binding (GO:0005524), glutathione synthase activity (GO:0004363)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GSH_synth_ATP