The domain within your query sequence starts at position 5 and ends at position 294; the E-value for the G_path_suppress domain shown below is 6.1e-93.
LERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEE TKEQILKLQEKLSALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHT GTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSP GGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFL QPGSTLSLQKQMEHANQQTSFSDSSSLRPMHPQALHPAPGLLASPQLPVQ
G_path_suppress |
---|
PFAM accession number: | PF15991 |
---|---|
Interpro abstract (IPR026094): | G protein pathway suppressor 2 is involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this protein could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this protein may be signal repression [ (PUBMED:8943324) ]. This protein is a component of the N-CoR-HDAC3 [ (PUBMED:11931768) ] and also the SMRT corepressor complexes [ (PUBMED:19858209) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry G_path_suppress