The domain within your query sequence starts at position 1 and ends at position 129; the E-value for the Gaa1 domain shown below is 1.9e-46.
XSASTESLVLTVPCGPDATNSQAVGLLLALAAHFRGQIYWAKDIIFLVTDHDLLGTEAWL EAYHDINVTGIQSSPLQGRAGAIQAAVALELSSDVVTSLDVTVEGLNAAAPGLDVTRRAV AGFADTATH
Gaa1 |
---|
PFAM accession number: | PF04114 |
---|---|
Interpro abstract (IPR007246): | GPI (glycosyl phosphatidyl inositol) transamidase is a multiprotein complex required for a terminal step of adding the glycosylphosphatidylinositol (GPI) anchor attachment onto proteins. Gpi16, Gpi8 and Gaa1 form a sub-complex of the GPI transamidase. |
GO component: | GPI-anchor transamidase complex (GO:0042765), integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gaa1