The domain within your query sequence starts at position 1 and ends at position 382; the E-value for the Gal-3-0_sulfotr domain shown below is 8.4e-150.
MSILRGTQRSFQVALWFLVLAVFLLVVFLHVDFRLLIPDKVQEPPVTNIMFLKTHKTASS TILNILYRFSESHNLSTALPEGSRVHLGYPWLFVTRYVEGLKQDAHLQHHFNIMCNHLRF NYPEVQKVMPRDTFYFSILRNPVFQLESSFIYYKDYAPAFQRAKSLDEFLADPWKYYKAS VSLENVYAKNNMWFDFGFDNNAPADKDYVRKCLAEVEQRFHLVLIADYFDESMVLLRRRL RWQLDDVVSFKLNVRSQSTVSHLTPESQERVQHWCALDWQLYQHFNRTFWTQLHAELSPR QLTEEVEQLRERQRELMALCLQDPEPKNLTHIDDRNLRPYQSGKAKILGYKLRHGLDTTT LHICQRMAMPELQHMAHMYSLQ
Gal-3-0_sulfotr |
---|
PFAM accession number: | PF06990 |
---|---|
Interpro abstract (IPR009729): | This family consists of several animal galactose-3-O-sulphotransferases, including GAL3ST1-4. GAL3ST1 (also known as Cst, cerebroside sulfotransferase) is responsible for the biosynthesis of two types of sulfoglycolipids, sulfatide (HSO3-3-galactosylceramide) and seminolipid (HSO3-3-monogalactosylalkylacylglycerol), in mammals. It catalyses the sulfation of membrane glycolipids and seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. It also catalyses the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes [ (PUBMED:11917099) ]. |
GO process: | glycolipid biosynthetic process (GO:0009247) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | galactosylceramide sulfotransferase activity (GO:0001733) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gal-3-0_sulfotr