The domain within your query sequence starts at position 254 and ends at position 320; the E-value for the Gal_mutarotas_2 domain shown below is 6.5e-12.
SQHITGLGEHLSPLMLSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLL NSNAMDV
Gal_mutarotas_2 |
---|
PFAM accession number: | PF13802 |
---|---|
Interpro abstract (IPR025887): | This domain is found in proteins that belong to the glycoside hydrolase family 31. The domain appears to be similar to the galactose mutarotase superfamily. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gal_mutarotas_2