The domain within your query sequence starts at position 50 and ends at position 129; the E-value for the Gemin7 domain shown below is 1.9e-45.
ESQEQRARATLRERYLRSLLAMVGHPVSFTLHEGVHVTAQFGATDLDVANFYVSQLQTPI GVQAEALLRCSDIISYSFKL
Gemin7 |
 |
|---|
| PFAM accession number: | PF11095 |
|---|---|
| Interpro abstract (IPR020338): | Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins. Gemin7 interacts with several Sm proteins of spliceosomal small nuclear ribonucleoproteins, especially SmE [ (PUBMED:12065586) ]. Gem-associated protein 7 is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene [ (PUBMED:12065586) ]. |
| GO component: | SMN-Sm protein complex (GO:0034719) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gemin7