The domain within your query sequence starts at position 1 and ends at position 206; the E-value for the Gly_acyl_tr_N domain shown below is 3.7e-112.
MLHLRSSQMLQMLESSLRKYLPESLKVYGTVFHMNQGNPFKLKALVDKWPDFNTVVVRPR EQEMGDDLDQHTNTYQIYSKDPKHCLEFLGTPDVINWKQHLQIQSSQSNLNEAIMDLAAG KMVKVKRTQCILYMMPETAKKLVPSLLEDKEYLDHQSGRPRAIDQEMFKLSTLDVTHAPL VDKFWQFGGNERSQRFIGRCIQIFPS
Gly_acyl_tr_N |
---|
PFAM accession number: | PF06021 |
---|---|
Interpro abstract (IPR015938): | This entry represents glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; EC 2.3.1.13 ). Mitochondrial acyltransferases catalyse the transfer of an acyl group from acyl-CoA to the N terminus of glycine to produce N-acylglycine. These enzymes can conjugate a multitude of substrates to form a variety of N-acylglycines. The CoA derivatives of a number of aliphatic and aromatic acids, but not phenylacetyl-CoA or (indol-3-yl)acetyl-CoA, can act as donor [ (PUBMED:10630424) (PUBMED:8660675) ]. |
GO component: | mitochondrion (GO:0005739) |
GO function: | glycine N-acyltransferase activity (GO:0047961) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gly_acyl_tr_N