The domain within your query sequence starts at position 39 and ends at position 164; the E-value for the Glyco_hydro_15 domain shown below is 3.5e-26.
DKLDHYYRIVKSTMLMYQSPTTGLFPTKTCGGEEKSKVHESLYCAAGAWALALAYRRIDD DKGRTHELEHSAIKCMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFSVHTGDELLSYEE YGHLQI
Glyco_hydro_15 |
![]() |
---|
PFAM accession number: | PF00723 |
---|---|
Interpro abstract (IPR011613): | This entry represents a domain found in glycoside hydrolase family 15 members and in phosphorylase b kinase regulatory chains alpha and beta [ (PUBMED:18950708) ]. Glycoside hydrolase family 15 comprises enzymes with several known activities; glucoamylase ( EC 3.2.1.3 ); alpha-glucosidase ( EC 3.2.1.20 ); glucodextranase ( EC 3.2.1.70 ). Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin. The beta chain acts as a regulatory unit and modulates the activity of the holoenzyme in response to phosphorylation [ (PUBMED:12825073) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_15