The domain within your query sequence starts at position 35 and ends at position 223; the E-value for the Glyco_hydro_2_N domain shown below is 4e-46.
SRELKALDGLWHFRADLSNNRLQGFEQQWYRQPLRESGPVLDMPVPSSFNDITQEAALRD FIGWVWYEREAILPRRWTQDTDMRVVLRINSAHYYAVVWVNGIHVVEHEGGHLPFEADIS KLVQSGPLTTCRITIAINNTLTPHTLPPGTIVYKTDTSMYPKGYFVQDTSFDFFNYAGLH RSVVLYTTP
Glyco_hydro_2_N |
---|
PFAM accession number: | PF02837 |
---|---|
Interpro abstract (IPR006104): | Proteins containing this domain include beta-galactosidases, beta-mannosidases and beta-glucuronidases. The domain has a jelly-roll fold [ (PUBMED:8008071) ]. |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO function: | hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_2_N