The domain within your query sequence starts at position 34 and ends at position 188; the E-value for the Glyco_hydro_35 domain shown below is 1.6e-71.

RFLLDGVPFRYVSGSLHYFRVPPVLWADRLLKMQLSGLNAVQFYVPWNYHEPEPGIYNFN
GSRDLIAFLNEAAKVNLLVILRPGPYICAEWEMGGLPSWLLRNPNIHLRTSDPAFLEAVD
SWFKVLLPKIYPFLYHNGGNIISIQVENEYGSYKA

Glyco_hydro_35

Glyco_hydro_35
PFAM accession number:PF01301
Interpro abstract (IPR031330):

O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website.

Glycoside hydrolase family 35 comprises enzymes with only one known activity; beta-galactosidase ( EC 3.2.1.23 ).

Mammalian beta-galactosidase is a lysosomal enzyme (gene GLB1) which cleaves the terminal galactose from gangliosides, glycoproteins, and glycosaminoglycans and whose deficiency is the cause of the genetic disease Gm(1) gangliosidosis (Morquio disease type B).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_35