The domain within your query sequence starts at position 34 and ends at position 188; the E-value for the Glyco_hydro_35 domain shown below is 1.6e-71.
RFLLDGVPFRYVSGSLHYFRVPPVLWADRLLKMQLSGLNAVQFYVPWNYHEPEPGIYNFN GSRDLIAFLNEAAKVNLLVILRPGPYICAEWEMGGLPSWLLRNPNIHLRTSDPAFLEAVD SWFKVLLPKIYPFLYHNGGNIISIQVENEYGSYKA
Glyco_hydro_35 |
---|
PFAM accession number: | PF01301 |
---|---|
Interpro abstract (IPR031330): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. Glycoside hydrolase family 35 comprises enzymes with only one known activity; beta-galactosidase ( EC 3.2.1.23 ). Mammalian beta-galactosidase is a lysosomal enzyme (gene GLB1) which cleaves the terminal galactose from gangliosides, glycoproteins, and glycosaminoglycans and whose deficiency is the cause of the genetic disease Gm(1) gangliosidosis (Morquio disease type B). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_35