The domain within your query sequence starts at position 1 and ends at position 268; the E-value for the Glyco_hydro_38C domain shown below is 1.6e-50.
YGTTNKRDKSGAYLFLPDGQGQPYVSLRPPFVRVTRGRIYSDVTCFLEHVTHKVRLYNIQ GIEGQSMEVSNIVNIRNVHNREIVMRISSKINNQNRYYTDLNGYQIQPRRTMSKLPLQAN VYPMCTMAYIQDAEHRLTLLSAQSLGASSMASGQIEVFMDRRLMQDDNRGLGQGVHDNKI TANLFRILLEKRSAVNMEEEKKSPVSYPSLLSHMTSSFLNHPFLPMVLSGQLPSPAFELL SEFPLLQSSLPCDIHLLGLVHLLSQMLS
Glyco_hydro_38C |
![]() |
---|
PFAM accession number: | PF07748 |
---|---|
Interpro abstract (IPR011682): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. Glycoside hydrolase family 38 comprises enzymes with only one known activity; alpha-mannosidase ( EC 3.2.1.24 ) ( EC 3.2.1.114 ). This domain is found at the C terminus of glycosyl hydrolases from family 38. |
GO process: | mannose metabolic process (GO:0006013) |
GO function: | alpha-mannosidase activity (GO:0004559) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_38C