The domain within your query sequence starts at position 48 and ends at position 188; the E-value for the Glyco_hydro_42 domain shown below is 6.4e-10.
SLHYFRVPPVLWADRLLKMQLSGLNAVQFYVPWNYHEPEPGIYNFNGSRDLIAFLNEAAK VNLLVILRPGPYICAEWEMGGLPSWLLRNPNIHLRTSDPAFLEAVDSWFKVLLPKIYPFL YHNGGNIISIQVENEYGSYKA
Glyco_hydro_42 |
![]() |
---|
PFAM accession number: | PF02449 |
---|---|
Interpro abstract (IPR013529): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. This group of beta-galactosidase enzymes ( EC 3.2.1.23 ) belong to the glycosyl hydrolase 42 family . The enzyme catalyses the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO component: | beta-galactosidase complex (GO:0009341) |
GO function: | beta-galactosidase activity (GO:0004565) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_42